PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009143180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family BES1
Protein Properties Length: 672aa    MW: 75075.5 Da    PI: 6.3055
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009143180.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822144.21.1e-44561851128
          DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslq 95 
                     ggs+r+++ +E+E++k+RER+RRai+a+i+ GLR++Gny+l++raD+n+V++AL+reAGwvv +DGtt++  s+ ++ ++++g s+  +++s+  
  XP_009143180.1  56 GGSRRSRPVEEKERTKLRERHRRAITARILGGLRRHGNYNLRVRADINDVIAALAREAGWVVLPDGTTFPSKSQGTKPPAVVGGSSASHQSSPPA 150
                     689*******************************************************************8888888889999999999999999 PP

          DUF822  96 .sslkssalaspvesysaspksssfps.pssldsi 128
                         + s  +sp+e   +++k +  p  ps +d  
  XP_009143180.1 151 lRGGSLSGHRSPTELNTCRMKGVFAPTtPSPYDVQ 185
                     4445558899***********99887524445444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056873.5E-3857190IPR008540BES1/BZR1 plant transcription factor, N-terminal
SuperFamilySSF514456.06E-171224668IPR017853Glycoside hydrolase superfamily
Gene3DG3DSA:3.20.20.806.3E-186227669IPR013781Glycoside hydrolase, catalytic domain
PfamPF013736.8E-93233652IPR001554Glycoside hydrolase, family 14
PRINTSPR007502.3E-63264278IPR001554Glycoside hydrolase, family 14
PRINTSPR007502.3E-63285303IPR001554Glycoside hydrolase, family 14
PRINTSPR007502.3E-63307328IPR001554Glycoside hydrolase, family 14
PROSITE patternPS005060311319IPR018238Glycoside hydrolase, family 14, conserved site
PRINTSPR007502.3E-63400422IPR001554Glycoside hydrolase, family 14
PRINTSPR007502.3E-63473492IPR001554Glycoside hydrolase, family 14
PRINTSPR007502.3E-63507523IPR001554Glycoside hydrolase, family 14
PRINTSPR007502.3E-63524535IPR001554Glycoside hydrolase, family 14
PRINTSPR007502.3E-63542565IPR001554Glycoside hydrolase, family 14
PRINTSPR007502.3E-63582604IPR001554Glycoside hydrolase, family 14
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000272Biological Processpolysaccharide catabolic process
GO:0048831Biological Processregulation of shoot system development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0016161Molecular Functionbeta-amylase activity
Sequence ? help Back to Top
Protein Sequence    Length: 672 aa     Download sequence    Send to blast
MQKLLGASEE DEEEEMDADV KEEDDGNRGS HAASGSSNDE FMFHQSSMQD QVDTPGGSRR  60
SRPVEEKERT KLRERHRRAI TARILGGLRR HGNYNLRVRA DINDVIAALA REAGWVVLPD  120
GTTFPSKSQG TKPPAVVGGS SASHQSSPPA LRGGSLSGHR SPTELNTCRM KGVFAPTTPS  180
PYDVQSSELV GSLNKADGLI GCPVDVINSK QILEIPPNLT EQDFSGTPYV PVYVMLPLGV  240
INMKCELADR DGLLKHLRIL KSIQVDGVKV DCWWGIAECH SPQEYNWNGY RQLFQIVRDL  300
NLKIQVLMSF HECGGNVGDD VCIPLPHWVA EIGRTNPDIY FTDREGRRNP ECLSWGIDKE  360
RVLRGRTALE VYFDYMRSFR IELGEFVEDG VISMVEIGLG PCGELRYPSC PIKHGWRYPG  420
VGEFQCYDKY LLKSLRKAAE SRGHPFWARG PENAGSYNSQ PQGTGFFCDG GDYDGLYGRF  480
FLKWYSQVLI DHADKVLSLA KLVFDTSCIA AKLPDVHWWY RTASHAAELT AGFYNPSNRD  540
GYAEIASTLK KHGAALSFVS GEVQVLNRPD DFSGALGEPE AVAWQVLNAA WDTDTPIARE  600
NSLPCHDRVG FNKMLESVKF PNDPDRRHLS SFAYSRLVPA LMEGHNLVEF DRFVKKLHGE  660
AVMDHQHHHQ QV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wdq_A1e-13922966011444Beta-amylase
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2273230.0AK227323.1 Arabidopsis thaliana mRNA for putative beta-amylase, complete cds, clone: RAFL14-01-P19.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013748118.10.0PREDICTED: beta-amylase 7-like
RefseqXP_009143179.10.0PREDICTED: beta-amylase 7 isoform X1
SwissprotO808310.0BAM7_ARATH; Beta-amylase 7
TrEMBLM4CL580.0M4CL58_BRARP; Beta-amylase
STRINGBra004944.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45880.10.0beta-amylase 7